Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial

This Recombinant Human MHC class I polypeptide-related sequence B (MICB), partial spans the amino acid sequence from region 204-297aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

O16470

Expression Region

204-297aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTR5A (5-hydroxytryptamine (Serotonin) Receptor 5A, 5-HT5A, MGC138226) (Biotin)
247333-Biotin 100 µL

HTR5A (5-hydroxytryptamine (Serotonin) Receptor 5A, 5-HT5A, MGC138226) (Biotin)

Sign In for Pricing
View Details
POU3F4 AAV siRNA Pooled Vector
37263161 1.0 µg

POU3F4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF405S conjugate, 0.1mg/mL
BNC041967-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Map4k1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
28040114 3x 1.0 µg

Map4k1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Gpr34 Mouse shRNA Lentiviral Particle (Locus ID 23890)
TL509853V 500 µL Each

Gpr34 Mouse shRNA Lentiviral Particle (Locus ID 23890)

Sign In for Pricing
View Details
Nhe I phosphorylated linker; 20 ug
26-3200-27 20 µg

Nhe I phosphorylated linker; 20 ug

Sign In for Pricing
View Details