Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD58 protein (CD58), partial, Biotinylated

This Recombinant Human CD58 protein (CD58), partial, Biotinylated spans the amino acid sequence from region 29-215aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD58

UniProt

Q9BRW0

Expression Region

29-215aa

Tag

C-terminal 10xHis-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F6]
TA506240AM 100 µL

CD19 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F6]

Sign In for Pricing
View Details
Human MAGI1 Protein, GST Tag
E40KMPH5145 20 µg

Human MAGI1 Protein, GST Tag

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)
TRV-0022854-01 100 µL

FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)
TRV-0022854-02 200 µL

FITC-Linked Polyclonal Antibody to Epithelial Neutrophil Activating Peptide 78 (ENA78)

Sign In for Pricing
View Details
Cornmeal Agar
30622002-1 100 g

Cornmeal Agar

Sign In for Pricing
View Details
ODN 1826- Type B murine TLR9 Agonist Biotin conjugate, antigen grade
ODN1826-B 50 µg

ODN 1826- Type B murine TLR9 Agonist Biotin conjugate, antigen grade

Sign In for Pricing
View Details