Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis cytokine receptor-like factor 2 (CRLF2), partial (Active)

This Recombinant Macaca fascicularis cytokine receptor-like factor 2 (CRLF2), partial spans the amino acid sequence from region 23-231aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CRLF2

Expression Region

23-231aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis CRLF2 at 2 μg/mL can bind Anti-CRLF2 recombinant antibody. The EC50 is 2.079-2.450 ng/mL.

Form

Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QVATGEGLQIQIMYFNLETVQVTWNASHYPRSNLSFHYKFSRDEAYDQCTVYILQEGHTSGCLLDAQQQDDILYFSIRNGTHPVFTASRWIFYYLKPSSPKQVSFSWHQDAVTLTCSDLSYRGLLYEVQYRSPFDTEWQSKQENTCNVTIEDLDAEKCYAFRARVKAMEDAYGPDTYPSDWSEVTCWQRGKTRDSCPEPRTPPKPKLSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)
MBS2112064-01 0.1 mL

Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)

Sign In for Pricing
View Details
Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)
MBS2112064-02 0.2 mL

Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)

Sign In for Pricing
View Details
Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)
MBS2112064-03 0.5 mL

Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)

Sign In for Pricing
View Details
Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)
MBS2112064-04 1 mL

Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)

Sign In for Pricing
View Details
Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)
MBS2112064-05 5 mL

Polyclonal Antibody to Runt Related Transcription Factor 2 (RUNX2)

Sign In for Pricing
View Details
Trk A discontinued
346342-01 100 µL

Trk A discontinued

Sign In for Pricing
View Details