Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis serovar D Histone H1-like protein Hc1 (hctA)

This Recombinant Chlamydia trachomatis serovar D Histone H1-like protein Hc1 (hctA) spans the amino acid sequence from region 2-125aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

18 kDa histone analog

UniProt

P0CE15

Expression Region

2-125aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALKDTAKKMTDLLESIQQNLLKAEKGNKAAAQRVRTESIKLEKIAKVYRKESIKAEKMGLMKKSKAAAKKAKAAAKKPVRAAKTVAKKACTKRTCATKAKVKPTKKAAPKTKVKTAKKTRSTKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal A20/TNFAIP3 Antibody [DyLight 594]
NBP1-77024DL594 0.1 mL

Rabbit Polyclonal A20/TNFAIP3 Antibody [DyLight 594]

Sign In for Pricing
View Details
Mouse DGKQ siRNA
abx914072-01 15 nmol

Mouse DGKQ siRNA

Sign In for Pricing
View Details
Mouse DGKQ siRNA
abx914072-02 30 nmol

Mouse DGKQ siRNA

Sign In for Pricing
View Details
KIAA1524 Mouse Monoclonal Antibody [KD Validation]
E51K3818 40 µL

KIAA1524 Mouse Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
FZD4 Rabbit Polyclonal Antibody (Biotin)
orb456778 100 µL

FZD4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Oleic Acid 75% Food Grade
GPC9306-I 10 L

Oleic Acid 75% Food Grade

Sign In for Pricing
View Details