Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis serovar D Histone H1-like protein Hc1 (hctA)

This Recombinant Chlamydia trachomatis serovar D Histone H1-like protein Hc1 (hctA) spans the amino acid sequence from region 2-125aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

18 kDa histone analog

UniProt

P0CE15

Expression Region

2-125aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALKDTAKKMTDLLESIQQNLLKAEKGNKAAAQRVRTESIKLEKIAKVYRKESIKAEKMGLMKKSKAAAKKAKAAAKKPVRAAKTVAKKACTKRTCATKAKVKPTKKAAPKTKVKTAKKTRSTKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYL2 Conjugated Antibody
MBS9446289-01 0.1 mL (Biotin)

MYL2 Conjugated Antibody

Sign In for Pricing
View Details
MYL2 Conjugated Antibody
MBS9446289-02 0.1 mL (AF350)

MYL2 Conjugated Antibody

Sign In for Pricing
View Details
MYL2 Conjugated Antibody
MBS9446289-03 0.1 mL (AF405)

MYL2 Conjugated Antibody

Sign In for Pricing
View Details
MYL2 Conjugated Antibody
MBS9446289-04 0.1 mL (AF488)

MYL2 Conjugated Antibody

Sign In for Pricing
View Details
MYL2 Conjugated Antibody
MBS9446289-05 0.1 mL (AF555)

MYL2 Conjugated Antibody

Sign In for Pricing
View Details
MYL2 Conjugated Antibody
MBS9446289-06 0.1 mL (AF594)

MYL2 Conjugated Antibody

Sign In for Pricing
View Details