Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-1 receptor type 1 (IL1R1), partial

This Recombinant Human Interleukin-1 receptor type 1 (IL1R1), partial spans the amino acid sequence from region 21-332aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-1R-1; IL-1RT-1; IL-1RT1; CD121 antigen-like family member A; Interleukin-1 receptor alpha; IL-1R-alpha; Interleukin-1 receptor type I; p80; CD antigen CD121a; mIL-1R1; mIL-1RI; sIL-1R1; sIL-1RI

UniProt

P14778

Expression Region

21-332aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amy2 Protein Vector (Rat) (pPB-C-His)
PV253470 500 ng

Amy2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal MDA5 Antibody (Hely-1) [Janelia Fluor 646]
NBP3-11673JF646 0.1 mL

Mouse Monoclonal MDA5 Antibody (Hely-1) [Janelia Fluor 646]

Sign In for Pricing
View Details
Zinc finger FYVE domain-containing protein 19 (ZFYVE19) Human ELISA Kit
I3208 96 Tests

Zinc finger FYVE domain-containing protein 19 (ZFYVE19) Human ELISA Kit

Sign In for Pricing
View Details
PCGF5 CRISPR Activation Plasmid (h2)
sc-416432-ACT-2 20 µg

PCGF5 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Rabbit Polyclonal TrkB [p Tyr706, p Tyr707] Antibody [Alexa Fluor 594]
NBP2-54764AF594 0.1 mL

Rabbit Polyclonal TrkB [p Tyr706, p Tyr707] Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
OTUD1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-17563R-BF680 100 µL

OTUD1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details