Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Immunodominant staphylococcal antigen B (isaB)

This Recombinant Staphylococcus aureus Immunodominant staphylococcal antigen B (isaB) spans the amino acid sequence from region 37-175aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IsaB; SACOL2660

UniProt

Q5HCQ9

Expression Region

37-175aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain COL)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AITPYYTYNGYIGNNANFILDKNFINAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQKAYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Duodenum
CR559407 5 µg

Tissue Total RNA, Duodenum

Sign In for Pricing
View Details
D-Glucaro-1,4-lactone Monohydrate
TRC-G415600-250MG 250 mg

D-Glucaro-1,4-lactone Monohydrate

Sign In for Pricing
View Details
Recombinant Mouse 14-3-3 sigma/YWHAS Protein
PKSM040602 100 µg

Recombinant Mouse 14-3-3 sigma/YWHAS Protein

Sign In for Pricing
View Details
2-Hydroxy-1-phenyl-1-propanone
TRC-H950250-250MG 250 mg

2-Hydroxy-1-phenyl-1-propanone

Sign In for Pricing
View Details
TRP 7 (TRPC7) Mouse Monoclonal Antibody [Clone ID: N64A/36]
75-123 100 µL

TRP 7 (TRPC7) Mouse Monoclonal Antibody [Clone ID: N64A/36]

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Hydroxy PEG
125000-0.25G 25 g

Ɑ-Methoxy-ω-Hydroxy PEG

Sign In for Pricing
View Details