Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Immunodominant staphylococcal antigen B (isaB)

This Recombinant Staphylococcus aureus Immunodominant staphylococcal antigen B (isaB) spans the amino acid sequence from region 37-175aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IsaB; SACOL2660

UniProt

Q5HCQ9

Expression Region

37-175aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus (strain COL)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AITPYYTYNGYIGNNANFILDKNFINAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQKAYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A830018L16Rik (NM_001160370) Mouse Tagged Lenti ORF Clone
MR226960L3 10 µg

A830018L16Rik (NM_001160370) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MRPS25 Protein Lysate (Rat) with C-HA Tag
30569036 100 µg

MRPS25 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
CDX1 Recombinant Antibody, APC-Cy7 Conjugated
bsm-61940R-APC-Cy7 100 µL

CDX1 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Exp 631
MBS5813044 Inquire

Exp 631

Sign In for Pricing
View Details
Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: LBI3H3]
AMM19461V 100 µL

Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: LBI3H3]

Sign In for Pricing
View Details
Rab31 (NM_133685) Mouse Tagged ORF Clone
MG218479 10 µg

Rab31 (NM_133685) Mouse Tagged ORF Clone

Sign In for Pricing
View Details