Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcription factor Jun (JUN)

This Recombinant Human Transcription factor Jun (JUN) spans the amino acid sequence from region 1-331aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activator protein 1; AP1; Proto-oncogene c-Jun; Transcription factor AP-1 subunit Jun; V-jun avian sarcoma virus 17 oncogene homolog; p39

UniProt

P05412

Expression Region

1-331aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCBLD1 Recombinant Protein Antigen
NBP2-32487PEP 0.1 mL

DCBLD1 Recombinant Protein Antigen

Sign In for Pricing
View Details
3''-O-Galloylmyricitrin
orb1684855 5 mg

3''-O-Galloylmyricitrin

Sign In for Pricing
View Details
MRPL21 siRNA (Human)
orb1851833-01 15 nmol

MRPL21 siRNA (Human)

Sign In for Pricing
View Details
MRPL21 siRNA (Human)
orb1851833-02 30 nmol

MRPL21 siRNA (Human)

Sign In for Pricing
View Details
Lentiviral mouse Gatad1 shRNA (UAS) - Lentiviral mouse Gatad1 shRNA (UAS, GFP) plasmid
GTR15278074 1 Vial

Lentiviral mouse Gatad1 shRNA (UAS) - Lentiviral mouse Gatad1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
AKAP 13 shRNA Plasmid (h)
sc-41721-SH 20 µg

AKAP 13 shRNA Plasmid (h)

Sign In for Pricing
View Details