Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Alpha-lactalbumin (LALBA)

This Recombinant Bovine Alpha-lactalbumin (LALBA) spans the amino acid sequence from region 20-142aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lactose synthase B protein; allergen Bos d 4

UniProt

P00711

Expression Region

20-142aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plekhg2 (BC052436) Mouse Tagged ORF Clone
MR211926 10 µg

Plekhg2 (BC052436) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ING5 Antibody
OAAN02203-100UL 100 µL

ING5 Antibody

Sign In for Pricing
View Details
Recombinant Shigella Flexneri rplN Protein (aa 1-123)
VAng-Lsx08096-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Flexneri rplN Protein (aa 1-123)

Sign In for Pricing
View Details
Compound NP-008941
MBS5795136 Inquire

Compound NP-008941

Sign In for Pricing
View Details
Vmn1r222 Mouse shRNA Plasmid (Locus ID 171274)
TL506154 1 Kit

Vmn1r222 Mouse shRNA Plasmid (Locus ID 171274)

Sign In for Pricing
View Details
Olr1562 AAV siRNA Pooled Vector
34039166 1.0 µg

Olr1562 AAV siRNA Pooled Vector

Sign In for Pricing
View Details