Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ragulator complex protein LAMTOR5 (LAMTOR5)

This Recombinant Human Ragulator complex protein LAMTOR5 (LAMTOR5) spans the amino acid sequence from region 1-91aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hepatitis B virus X-interacting protein; HBV X-interacting protein; HBX-interacting protein; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5

UniProt

O43504

Expression Region

1-91aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSBP1, Recombinant, Human, aa1-75, GST-Tag (Heat Shock Factor-binding Protein 1)
373685-01 20 µg

HSBP1, Recombinant, Human, aa1-75, GST-Tag (Heat Shock Factor-binding Protein 1)

Sign In for Pricing
View Details
HSBP1, Recombinant, Human, aa1-75, GST-Tag (Heat Shock Factor-binding Protein 1)
373685-02 100 µg

HSBP1, Recombinant, Human, aa1-75, GST-Tag (Heat Shock Factor-binding Protein 1)

Sign In for Pricing
View Details
HSBP1, Recombinant, Human, aa1-75, GST-Tag (Heat Shock Factor-binding Protein 1)
373685-03 1 mg

HSBP1, Recombinant, Human, aa1-75, GST-Tag (Heat Shock Factor-binding Protein 1)

Sign In for Pricing
View Details
Venlafaxine EP Impurity B
CS-EO-02762 1 Each

Venlafaxine EP Impurity B

Sign In for Pricing
View Details
ME2 Antibody Blocking peptide
orb1457998 500 µg

ME2 Antibody Blocking peptide

Sign In for Pricing
View Details
Olfr666 Mouse siRNA Oligo Duplex (Locus ID 259100)
SR410441 1 Kit

Olfr666 Mouse siRNA Oligo Duplex (Locus ID 259100)

Sign In for Pricing
View Details