Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Acyl-protein thioesterase 1 (Lypla1)

This Recombinant Mouse Acyl-protein thioesterase 1 (Lypla1) spans the amino acid sequence from region 1-230aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

APT-1; Lysophospholipase 1; Lysophospholipase I; LPL-I; LysoPLA I; Palmitoyl-protein hydrolase

UniProt

P97823

Expression Region

1-230aa

Tag

C-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Taf12 activation kit by CRISPRa
GA206795 1 Kit

Mouse Taf12 activation kit by CRISPRa

Sign In for Pricing
View Details
PEDF (SERPINF1) (N-term) Rabbit Polyclonal Antibody
AP17737PU-N 400 µL

PEDF (SERPINF1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PMS1 Mouse Monoclonal Antibody [Clone ID: OTI5E10]
CF810414 100 µg

PMS1 Mouse Monoclonal Antibody [Clone ID: OTI5E10]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS507378 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Frozen Tissue Sections, Neural tissue
CS647450 5x 5 µm

Frozen Tissue Sections, Neural tissue

Sign In for Pricing
View Details
PKC-beta 1 Antibody
KC-1280-01 50 μL

PKC-beta 1 Antibody

Sign In for Pricing
View Details