Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Acyl-protein thioesterase 1 (Lypla1)

This Recombinant Mouse Acyl-protein thioesterase 1 (Lypla1) spans the amino acid sequence from region 1-230aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

APT-1; Lysophospholipase 1; Lysophospholipase I; LPL-I; LysoPLA I; Palmitoyl-protein hydrolase

UniProt

P97823

Expression Region

1-230aa

Tag

C-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polysorbate 80 (Technical Grade)
TRC-P689433-25G 25 g

Polysorbate 80 (Technical Grade)

Sign In for Pricing
View Details
1-Bromo-3-phenoxybenzene
TRC-B687225-25G 25 g

1-Bromo-3-phenoxybenzene

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703953 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
G CSF (CSF3) (NM_001178147) Human Over-expression Lysate
LY432626 100 µg

G CSF (CSF3) (NM_001178147) Human Over-expression Lysate

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF640R conjugate, 0.1mg/mL
BNC402278-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Nitroso Dembrexine
TRC-N384985-50MG 50 mg

N-Nitroso Dembrexine

Sign In for Pricing
View Details