Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridioides difficile Cell wall-binding cysteine protease Cwp84 (lytC_12) (C116A), partial

This Recombinant Clostridioides difficile Cell wall-binding cysteine protease Cwp84 (lytC_12) (C116A), partial spans the amino acid sequence from region 92-518aa (C116A) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-acetylmuramoyl-L-alanine amidase LytC; lytC_12 ; lytC_15

UniProt

A0A6N2YE28

Expression Region

92-518aa (C116A)

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Clostridioides difficile (Peptoclostridium difficile)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSVAYNPMNLGLTTPAKNQGSLNTAWSFSGMSTLEAYLKLKGYGTYDLSEEHLRWWATGGKYGWNLDDMSGSSNVTAIGYLTAWAGPKLEKDIPYNLKSEAQGATKPSNMDTAPTQFNVTDVVRLNKDKETVKNAIMQYGSVTSGYAHYSTYFNKDETAYNCTNKRAPLNHAVAIVGWDDNYSKDNFASDVKPESNGAWLVKSSWGEFNSMKGFFWISYEDKTLLTDTDNYAMKSVSKPDSDKKMYQLEYAGLSKIMSNKVTAANVFDFSRDSEKLDSVMFETDSVGAKYEVYYAPVVNGVPQNNSMTKLASGTVSYSGYINVPTNSYSLPKGKGAIVVVIDNTANPNREKSTLAYETNIDAYYLYEAKANLGESYILQNNKFEDINTYSEFSPCNFVIKAITKTSSGQATSGESLTGADRYETAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Galr3 activation kit by CRISPRa
GA201540 1 Kit

Mouse Galr3 activation kit by CRISPRa

Sign In for Pricing
View Details
ADK Antibody (Biotin)
KB-27365-01 50 μL

ADK Antibody (Biotin)

Sign In for Pricing
View Details
ADK Antibody (Biotin)
KB-27365-02 100 µL

ADK Antibody (Biotin)

Sign In for Pricing
View Details
ADK Antibody (Biotin)
KB-27365-03 1 mL

ADK Antibody (Biotin)

Sign In for Pricing
View Details
Automation Reservoirs
RES30SW-384-N 50 Pack/Case

Automation Reservoirs

Sign In for Pricing
View Details
Tiafenacil Metabolite M-56
TRC-T436340-1MG 1 mg

Tiafenacil Metabolite M-56

Sign In for Pricing
View Details