Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1), partial

This Recombinant Human Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1), partial spans the amino acid sequence from region 1-327aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bcl-2-like protein 3 (Bcl2-L-3) ; Bcl-2-related protein EAT/mcl1; mcl1/EAT

UniProt

Q07820

Expression Region

1-327aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hmgxb3 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4047204 1.0 µg DNA

Hmgxb3 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
RFX1, CT (RFX1, MHC class II regulatory factor RFX1, Enhancer factor C, Regulatory factor X 1, Transcription factor RFX1) (MaxLight 490)
MBS6341527-01 0.1 mL

RFX1, CT (RFX1, MHC class II regulatory factor RFX1, Enhancer factor C, Regulatory factor X 1, Transcription factor RFX1) (MaxLight 490)

Sign In for Pricing
View Details
RFX1, CT (RFX1, MHC class II regulatory factor RFX1, Enhancer factor C, Regulatory factor X 1, Transcription factor RFX1) (MaxLight 490)
MBS6341527-02 5x 0.1 mL

RFX1, CT (RFX1, MHC class II regulatory factor RFX1, Enhancer factor C, Regulatory factor X 1, Transcription factor RFX1) (MaxLight 490)

Sign In for Pricing
View Details
HEY1 Antibody - middle region : HRP (ARP41453_P050-HRP)
ARP41453_P050-HRP 100 µL

HEY1 Antibody - middle region : HRP (ARP41453_P050-HRP)

Sign In for Pricing
View Details
Benzyl (8-hydroxyoctyl) carbamate
HY-W819785-01 50 mg

Benzyl (8-hydroxyoctyl) carbamate

Sign In for Pricing
View Details
Benzyl (8-hydroxyoctyl) carbamate
HY-W819785-02 100 mg

Benzyl (8-hydroxyoctyl) carbamate

Sign In for Pricing
View Details