Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial

This Recombinant Human MHC class I polypeptide-related sequence A (MICA), partial spans the amino acid sequence from region 24-307aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MIC-A

UniProt

Q29983

Expression Region

24-307aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Undecanenitrile
sc-476848 25 g

Undecanenitrile

Sign In for Pricing
View Details
Pgd (NM_001081274) Mouse Recombinant Protein
PM42945M5 20 µg

Pgd (NM_001081274) Mouse Recombinant Protein

Sign In for Pricing
View Details
Connexin 43 Rabbit Polyclonal Antibody, 1 pack = 50 µL
BAL4494 1 Each

Connexin 43 Rabbit Polyclonal Antibody, 1 pack = 50 µL

Sign In for Pricing
View Details
Crystal Mount-Base-Assembly
JBS-HTB-M7-XX-BY 20 Eqch

Crystal Mount-Base-Assembly

Sign In for Pricing
View Details
WTAP Protein Vector (Mouse) (pPM-C-HA)
PV247680 500 ng

WTAP Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
RAB35 Polyclonal Antibody
MBS2575515-01 0.06 mL

RAB35 Polyclonal Antibody

Sign In for Pricing
View Details