Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis MHC class I polypeptide-related sequence B (MICB), partial (Active)

This Recombinant Macaca fascicularis MHC class I polypeptide-related sequence B (MICB), partial spans the amino acid sequence from region 31-297aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Expression Region

31-297aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis at 2 μg/mL can bind Anti-MICA/B recombinant antibody. The EC50 is 1.749-2.065 ng/mL.

Form

Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELHSLRYNVTVLSRDGSVQSGFLAEGHLDGQLFVRYDRETRRARPQGQWAEAVLGDQETEDLTENAQDLRRTLTHIEGQKGGLHSLQKIKICEIYEDGSTGGFWHFYYDGELFLSLNLETQKWTVAQSSRAQTLAMSFWKEDTMKTNTHYRAMRADCLKKLRRYQKSRVAVRRTVPPMVNVTHGEASEGNITVTCRASGFYPGNITLTWRQDGVSLSHDAQQWGDVLPDRNGTYYTWVATRIRQGEEQKFACYMEHSGNHSTHPVPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHSY1, ID (CHSY1, CHSY, CSS1, KIAA0990, Chondroitin sulfate synthase 1, Chondroitin glucuronyltransferase 1, Chondroitin synthase 1, Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase 1, N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 1, N-acetylgalactosaminyltransferase 1) (PE) discontinued
033890-PE 200 µL

CHSY1, ID (CHSY1, CHSY, CSS1, KIAA0990, Chondroitin sulfate synthase 1, Chondroitin glucuronyltransferase 1, Chondroitin synthase 1, Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase 1, N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 1, N-acetylgalactosaminyltransferase 1) (PE) discontinued

Sign In for Pricing
View Details
Hamster Mitochondrial Uncoupling Protein 1 (MUP1) ELISA Kit
MBS9933133-01 48 Well

Hamster Mitochondrial Uncoupling Protein 1 (MUP1) ELISA Kit

Sign In for Pricing
View Details
Hamster Mitochondrial Uncoupling Protein 1 (MUP1) ELISA Kit
MBS9933133-02 96 Well

Hamster Mitochondrial Uncoupling Protein 1 (MUP1) ELISA Kit

Sign In for Pricing
View Details
Hamster Mitochondrial Uncoupling Protein 1 (MUP1) ELISA Kit
MBS9933133-03 5x 96 Well

Hamster Mitochondrial Uncoupling Protein 1 (MUP1) ELISA Kit

Sign In for Pricing
View Details
Hamster Mitochondrial Uncoupling Protein 1 (MUP1) ELISA Kit
MBS9933133-04 10x 96 Well

Hamster Mitochondrial Uncoupling Protein 1 (MUP1) ELISA Kit

Sign In for Pricing
View Details
IKK alpha (Inhibitor Of Nuclear Factor kappa-B Kinase alpha Subunit, I kappa-B Kinase alpha, IkBKA, IKK-A, IkappaB Kinase, I-kappa-B Kinase 1, IKK1, Conserved Helix-loop-Helix Ubiquitous Kinase, Nuclear Factor NFkappaB Inhibitor Kinase alpha, NFKBIKA, Transcription Factor 16, TCF-16, CHUK, IKKA, TCF16) (MaxLight 650)
128369-ML650 100 µL

IKK alpha (Inhibitor Of Nuclear Factor kappa-B Kinase alpha Subunit, I kappa-B Kinase alpha, IkBKA, IKK-A, IkappaB Kinase, I-kappa-B Kinase 1, IKK1, Conserved Helix-loop-Helix Ubiquitous Kinase, Nuclear Factor NFkappaB Inhibitor Kinase alpha, NFKBIKA, Transcription Factor 16, TCF-16, CHUK, IKKA, TCF16) (MaxLight 650)

Sign In for Pricing
View Details