Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse D-3-phosphoglycerate dehydrogenase (Phgdh)

This Recombinant Mouse D-3-phosphoglycerate dehydrogenase (Phgdh) spans the amino acid sequence from region 2-533aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

3-PGDH; A10

UniProt

Q61753

Expression Region

2-533aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWDRKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTVGYDPIISPEVAASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDSTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEAMGTLMHAWAGSPKGTIQVVTQGTSLKNAGTCLSPAVIVGLLREASKQADVNLVNAKLLVKEAGLNVTTSHNPGVPGEQGSGECLLTVALAGAPYQAVGLVQGTTPMLQMLNGAVFRPEVPLRRGQPLLVFRAQPSDPGMLPTMIGLLAEAGVQLLSYQTSMVSDGEPWHVMGLSSLLPSLETWKQHVLEAFQFCF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACP6 Protein Vector (Human) (pPM-C-His)
PV000392 500 ng

ACP6 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
4-Ethoxy-2- (trifluoromethyl) aniline
PC1006068-01 100 mg

4-Ethoxy-2- (trifluoromethyl) aniline

Sign In for Pricing
View Details
4-Ethoxy-2- (trifluoromethyl) aniline
PC1006068-02 250 mg

4-Ethoxy-2- (trifluoromethyl) aniline

Sign In for Pricing
View Details
4-Ethoxy-2- (trifluoromethyl) aniline
PC1006068-03 1 g

4-Ethoxy-2- (trifluoromethyl) aniline

Sign In for Pricing
View Details
Human GS ELISA Kit
orb1809180 96 Tests

Human GS ELISA Kit

Sign In for Pricing
View Details
C1QL2 (NM_182528) Human Over-expression Lysate
LS165257 100 µg

C1QL2 (NM_182528) Human Over-expression Lysate

Sign In for Pricing
View Details