Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial

This Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial spans the amino acid sequence from region 395-530aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PLA2-R; PLA2R;180 kDa secretory phospholipase A2 receptor; C-type lectin domain family 13 member C; M-type receptor; Soluble PLA2-R; Soluble PLA2R

UniProt

Q13018

Expression Region

395-530aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Human CD74 Antibody[LN2]
E-AB-F1072H-01 20 Tests

PE/Cyanine7 Anti-Human CD74 Antibody[LN2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD74 Antibody[LN2]
E-AB-F1072H-02 100 Tests

PE/Cyanine7 Anti-Human CD74 Antibody[LN2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD74 Antibody[LN2]
E-AB-F1072H-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD74 Antibody[LN2]

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR562273 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
EHMT1/GLP (EHMT1) (NM_024757) Human Over-expression Lysate
LY403026 100 µg

EHMT1/GLP (EHMT1) (NM_024757) Human Over-expression Lysate

Sign In for Pricing
View Details
KLF1 Rabbit Polyclonal Antibody
TA372463 100 µL

KLF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details