Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcription factor PU.1 (SPI1), Biotinylated

This Recombinant Human Transcription factor PU.1 (SPI1), Biotinylated spans the amino acid sequence from region 1-270aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

31 kDa-transforming protein; SPI1

UniProt

P17947

Expression Region

1-270aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

78.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amino-dPEG®12-ODMT
DPG-5812-01 100 mg

Amino-dPEG®12-ODMT

Sign In for Pricing
View Details
Amino-dPEG®12-ODMT
DPG-5812-02 1000 mg

Amino-dPEG®12-ODMT

Sign In for Pricing
View Details
ASB5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
12515061 1.0 µg DNA

ASB5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
H2AFX Protein Vector (Human) (pPM-C-HA)
PV019099 500 ng

H2AFX Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Sheep Immunoglobulin G4 ELISA Kit
MBS029295-01 48 Well

Sheep Immunoglobulin G4 ELISA Kit

Sign In for Pricing
View Details
Sheep Immunoglobulin G4 ELISA Kit
MBS029295-02 96 Well

Sheep Immunoglobulin G4 ELISA Kit

Sign In for Pricing
View Details