Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small proline-rich protein 2A (SPRR2A)

This Recombinant Human Small proline-rich protein 2A (SPRR2A) spans the amino acid sequence from region 1-72aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SPR-2A;2-1

UniProt

P35326

Expression Region

1-72aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPAG16 Double Nickase Plasmid (m)
sc-426166-NIC 20 µg

SPAG16 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Pigeon 4-Hydroxyphenylpyruvate Dioxygenase-Like Protein (HPDL) ELISA Kit
MBS9933796 Inquire

Pigeon 4-Hydroxyphenylpyruvate Dioxygenase-Like Protein (HPDL) ELISA Kit

Sign In for Pricing
View Details
APPBP1, CT (NEDD8-activating Enzyme E1 Regulatory Subunit, Amyloid Protein-binding Protein 1, Amyloid beta Precursor Protein-binding Protein 1, 59kD, APP-BP1, Proto-oncogene Protein 1, NAE1, HPP1) (MaxLight 650) discontinued
A2275-87M-ML650 100 µL

APPBP1, CT (NEDD8-activating Enzyme E1 Regulatory Subunit, Amyloid Protein-binding Protein 1, Amyloid beta Precursor Protein-binding Protein 1, 59kD, APP-BP1, Proto-oncogene Protein 1, NAE1, HPP1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
NRCAM Rabbit pAb
E920160 100 µL

NRCAM Rabbit pAb

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Spike Antibody, Mouse IgG1 (2C9C9) (XBB.1.5/Omicron Specific)
SPN-Y169-1mg 1 mg

Anti-SARS-CoV-2 Spike Antibody, Mouse IgG1 (2C9C9) (XBB.1.5/Omicron Specific)

Sign In for Pricing
View Details
Zebrafish DPYD Rabbit Polyclonal Antibody (Carrier-free)
orb3130382 100 µg

Zebrafish DPYD Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details