Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymic stromal lymphopoietin (TSLP) (Active)

This Recombinant Human Thymic stromal lymphopoietin (TSLP) (Active) spans the amino acid sequence from region 29-159aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymic stromal lymphopoietin; TSLP

UniProt

Q969D9

Expression Region

29-159aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA.Immobilized Human TSLP at 2 μg/mL can bind Anti-TSLP recombinant antibody. The EC50 is 5.487-6.214 ng/mL. 2Measured by its binding ability in a functional ELISA.Immobilized Human TSLP at 2 μg/mL can bind Human CRLF2 protein. The EC50 is 41.01-45.10 ng/mL.

Form

Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Polyclonal Antibody to Aryl Hydrocarbon Receptor Interacting Protein (AIP)
MBS2094371-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Aryl Hydrocarbon Receptor Interacting Protein (AIP)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Aryl Hydrocarbon Receptor Interacting Protein (AIP)
MBS2094371-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Aryl Hydrocarbon Receptor Interacting Protein (AIP)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Aryl Hydrocarbon Receptor Interacting Protein (AIP)
MBS2094371-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Aryl Hydrocarbon Receptor Interacting Protein (AIP)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Aryl Hydrocarbon Receptor Interacting Protein (AIP)
MBS2094371-04 1 mL

Biotin-Linked Polyclonal Antibody to Aryl Hydrocarbon Receptor Interacting Protein (AIP)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Aryl Hydrocarbon Receptor Interacting Protein (AIP)
MBS2094371-05 5 mL

Biotin-Linked Polyclonal Antibody to Aryl Hydrocarbon Receptor Interacting Protein (AIP)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Aryl Hydrocarbon Receptor Interacting Protein (AIP)
MBS2094371-06 5x 5 mL

Biotin-Linked Polyclonal Antibody to Aryl Hydrocarbon Receptor Interacting Protein (AIP)

Sign In for Pricing
View Details