Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uroplakin-3b (Upk3b), partial

This Recombinant Mouse Uroplakin-3b (Upk3b), partial spans the amino acid sequence from region 27-196aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UP3b; Uroplakin IIIb; UPIIIb; p35

UniProt

Q80YF6

Expression Region

27-196aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDLIAYVPQITAWDLEGKITATTFSLEQPRCVFDEHVSTKDTIWLVVAFSNASRDFQNPQTAAKIPTFPQLLTDGHYMTLPLSLDQLPCEDLTGGSGGAPVLRVGNDFGCYQRPYCNAPLPSQGPYSVKFLVMDAAGPPKAETKWSNPIYLHQGKNPNSIDTWPGRRSGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RIC3 Antibody [CoraFluor 1]
NBP2-97932CL1 0.1 mL

Rabbit Polyclonal RIC3 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Neurofilament (NF-H) (NF421), CF568 conjugate, 0.1mg/mL
BNC680421-100 1x 100 µL

Neurofilament (NF-H) (NF421), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lentiviral mouse Frmd8 shRNA (UAS) - Lentiviral mouse Frmd8 shRNA (UAS, GFP) (100)
GTR15240897 1 Vial

Lentiviral mouse Frmd8 shRNA (UAS) - Lentiviral mouse Frmd8 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human ARHGAP1 activation kit by CRISPRa
GA100282 1 Kit

Human ARHGAP1 activation kit by CRISPRa

Sign In for Pricing
View Details
SLFN14 Polyclonal Antibody, Cy3 Conjugated
bs-9190R-Cy3 100 µL

SLFN14 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
CCL20 siRNA (Human)
CRH4297-01 15 nmol

CCL20 siRNA (Human)

Sign In for Pricing
View Details