Recombinant Macaca fascicularis Parathyroid hormone (PTH) (Active)
This Recombinant Macaca fascicularis Parathyroid hormone (PTH) (Active) spans the amino acid sequence from region 32-115aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Parathyroid hormone; PTH; Parathyrin
UniProt
Q9XT35
Expression Region
32-115aa
Tag
C-terminal hFc-tagged
Source
Mammalian cell
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Field of Research
Metabolism Research
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis PTH1R at 2 μg/mL can bind Macaca fascicularis PTH. The EC50 is 346.7-417.7 ng/mL.
Form
Lyophilized powder
Molecular Weight
38.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFIALGAPLAPRDAGSQRPRKKEDNILVESHEKSLGEADKADVDVLTKAKSQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC743226-500 1x 500 µL
Prohibitin (Mitochondrial Marker) (PHB/3226), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details