Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Parathyroid hormone (PTH) (Active)

This Recombinant Macaca fascicularis Parathyroid hormone (PTH) (Active) spans the amino acid sequence from region 32-115aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parathyroid hormone; PTH; Parathyrin

UniProt

Q9XT35

Expression Region

32-115aa

Tag

C-terminal hFc-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Metabolism Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis PTH1R at 2 μg/mL can bind Macaca fascicularis PTH. The EC50 is 346.7-417.7 ng/mL.

Form

Lyophilized powder

Molecular Weight

38.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFIALGAPLAPRDAGSQRPRKKEDNILVESHEKSLGEADKADVDVLTKAKSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis (2-Hydroxyethyl) 2-Hydroxyterephthalate (BHET-OH)
TRC-B302760-50MG 50 mg

Bis (2-Hydroxyethyl) 2-Hydroxyterephthalate (BHET-OH)

Sign In for Pricing
View Details
Recombinant Cytokeratin-16 Antibody
RC-15408-01 50 μL

Recombinant Cytokeratin-16 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-16 Antibody
RC-15408-02 100 µL

Recombinant Cytokeratin-16 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-16 Antibody
RC-15408-03 1 mL

Recombinant Cytokeratin-16 Antibody

Sign In for Pricing
View Details
Homovanillic Acid-13C6
TRC-H669503-10MG 10 mg

Homovanillic Acid-13C6

Sign In for Pricing
View Details
Recombinant PRMT1 Antibody
RC-15213-01 50 μL

Recombinant PRMT1 Antibody

Sign In for Pricing
View Details