Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial (Active)

This Recombinant Macaca fascicularis natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial (Active) spans the amino acid sequence from region 25-259aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Expression Region

25-259aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis NCR3LG1 at 5 μg/mL on an Nickel Coated plate can bind Macaca fascicularis NCR3. The EC50 is 1.171-1.377 ng/mL.

Form

Lyophilized powder

Molecular Weight

27.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

DLKVEMMARGIQATRLNDSVTISCKVIYSQPLNITSMGITWFRKSLTLDKEVKVFEFFGDHQKAFRPGANVSLWRLKSGDASLKLPGVQLEEAGEYRCEVVVTPLKAQGTVQLKVVASPTSRLFQDQAVVKENEGKYMCESSRFYPKDINITWEKWTQKSPHHVVISENVITGPTIKNMDGTFNITSYLKLNSSQEDPGTVYRCVIRHESLHTPVSIDFILTAPQQSLSEPEKTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-500 1x 500 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF640R conjugate, 0.1mg/mL
BNC400449-500 1x 500 µL

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-100 1x 100 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-500 1x 500 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details