Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis MHC class I polypeptide-related sequence B (MICB), partial (Active)

This Recombinant Macaca fascicularis MHC class I polypeptide-related sequence B (MICB), partial (Active) spans the amino acid sequence from region 30-297aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Expression Region

30-297aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis MICB at 2 μg/mL can bind Anti-MICA/B recombinant antibody. The EC50 is 1.578-1.831 ng/mL.

Form

Lyophilized powder

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

AELHSLRYNVTVLSRDGSVQSGFLAEGHLDGQLFVRYDRETRRARPQGQWAEAVLGDQETEDLTENAQDLRRTLTHIEGQKGGLHSLQKIKICEIYEDGSTGGFWHFYYDGELFLSLNLETQKWTVAQSSRAQTLAMSFWKEDTMKTNTHYRAMRADCLKKLRRYQKSRVAVRRTVPPMVNVTHGEASEGNITVTCRASGFYPGNITLTWRQDGVSLSHDAQQWGDVLPDRNGTYYTWVATRIRQGEEQKFACYMEHSGNHSTHPVPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,3,7,8-Tetrafluorothianthrene 5-oxide
PC100658-01 100 mg

2,3,7,8-Tetrafluorothianthrene 5-oxide

Sign In for Pricing
View Details
2,3,7,8-Tetrafluorothianthrene 5-oxide
PC100658-02 250 mg

2,3,7,8-Tetrafluorothianthrene 5-oxide

Sign In for Pricing
View Details
2,3,7,8-Tetrafluorothianthrene 5-oxide
PC100658-03 1 g

2,3,7,8-Tetrafluorothianthrene 5-oxide

Sign In for Pricing
View Details
2,3,7,8-Tetrafluorothianthrene 5-oxide
PC100658-04 5 g

2,3,7,8-Tetrafluorothianthrene 5-oxide

Sign In for Pricing
View Details
2,3,7,8-Tetrafluorothianthrene 5-oxide
PC100658-05 10 g

2,3,7,8-Tetrafluorothianthrene 5-oxide

Sign In for Pricing
View Details
pECMV-Cic-m-FLAG Plasmid
PVT15489 2 µg

pECMV-Cic-m-FLAG Plasmid

Sign In for Pricing
View Details