Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aryl hydrocarbon receptor (AHR), partial

This Recombinant Human Aryl hydrocarbon receptor (AHR), partial spans the amino acid sequence from region 200-399aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Class E basic helix-loop-helix protein 76

UniProt

P35869

Expression Region

200-399aa

Tag

C-terminal hFc1-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGCDAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRWTWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Piccolo Antibody Blocking Peptide
orb1515127 500 µg

Piccolo Antibody Blocking Peptide

Sign In for Pricing
View Details
Human Fibulin 1 (FBLN1) ELISA Kit
RDR-FBLN1-Hu-96Tests 96 Tests

Human Fibulin 1 (FBLN1) ELISA Kit

Sign In for Pricing
View Details
SHBG Antibody
OAAN03678-100UL 100 µL

SHBG Antibody

Sign In for Pricing
View Details
PCDHGA2 (NM_032009) Human Over-expression Lysate
LS056113-20ug 20 µg

PCDHGA2 (NM_032009) Human Over-expression Lysate

Sign In for Pricing
View Details
AARS1 antibody
FNab00276 100 µg

AARS1 antibody

Sign In for Pricing
View Details
AMD Candida albicans (C. albicans) PCR Detection Kit
KD654298-100 100 Reactions

AMD Candida albicans (C. albicans) PCR Detection Kit

Sign In for Pricing
View Details