Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M3 Arginine repressor (argR2)

This Recombinant Streptococcus pyogenes serotype M3 Arginine repressor (argR2) spans the amino acid sequence from region 1-145aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ArgR2

UniProt

P0CZ70

Expression Region

1-145aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNKMERQQQIKRIIQAEHIGTQEDIKNHLQKEGIVVTQATLSRDLRAIGLLKLRDEQGKLYYSLSEPVATPFSPEVRFYVLKVDRAGFMLVLHTNLGEADVLANLIDNDAIEDILGTIAGADTLLVICRDEEIAKRFEKDLAAGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR51M1 CRISPR Knock Out 293T Cell Line (Human)
35306141 1x 10^6 Cells / 1.0 mL

OR51M1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
CD19 (CD19 Molecule, B4, MGC12802) (MaxLight 490)
MBS6205502-01 0.1 mL

CD19 (CD19 Molecule, B4, MGC12802) (MaxLight 490)

Sign In for Pricing
View Details
CD19 (CD19 Molecule, B4, MGC12802) (MaxLight 490)
MBS6205502-02 5x 0.1 mL

CD19 (CD19 Molecule, B4, MGC12802) (MaxLight 490)

Sign In for Pricing
View Details
Donkey Transglutaminase 4, Prostate ELISA Kit
MBS107220 Inquire

Donkey Transglutaminase 4, Prostate ELISA Kit

Sign In for Pricing
View Details
Recombinant Rat Batf3 Protein, His, E.coli-100ug
QP5704-ec-100ug 100ug

Recombinant Rat Batf3 Protein, His, E.coli-100ug

Sign In for Pricing
View Details
CdkL4 CRISPR Activation Plasmid (m)
sc-436243-ACT 20 µg

CdkL4 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details