Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Arylsulfatase K (ARSK)

This Recombinant Human Arylsulfatase K (ARSK) spans the amino acid sequence from region 23-536aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glucuronate-2-sulfatase; Telethon sulfatase

UniProt

Q6UWY0

Expression Region

23-536aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

66.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EQRRRAAKAPNVVLVVSDSFDGRLTFHPGSQVVKLPFINFMKTRGTSFLNAYTNSPICCPSRAAMWSGLFTHLTESWNNFKGLDPNYTTWMDVMERHGYRTQKFGKLDYTSGHHSISNRVEAWTRDVAFLLRQEGRPMVNLIRNRTKVRVMERDWQNTDKAVNWLRKEAINYTEPFVIYLGLNLPHPYPSPSSGENFGSSTFHTSLYWLEKVSHDAIKIPKWSPLSEMHPVDYYSSYTKNCTGRFTKKEIKNIRAFYYAMCAETDAMLGEIILALHQLDLLQKTIVIYSSDHGELAMEHRQFYKMSMYEASAHVPLLMMGPGIKAGLQVSNVVSLVDIYPTMLDIAGIPLPQNLSGYSLLPLSSETFKNEHKVKNLHPPWILSEFHGCNVNASTYMLRTNHWKYIAYSDGASILPQLFDLSSDPDELTNVAVKFPEITYSLDQKLHSIINYPKVSASVHQYNKEQFIKWKQSIGQNYSNVIANLRWHQDWQKEPRKYENAIDQWLKTHMNPRAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHMP2A Peptide - C-terminal region (AAP62112)
AAP62112-100UG 100 µg

CHMP2A Peptide - C-terminal region (AAP62112)

Sign In for Pricing
View Details
Galectin 12 (LGALS12) Antibody
abx176540-01 100 µL

Galectin 12 (LGALS12) Antibody

Sign In for Pricing
View Details
Galectin 12 (LGALS12) Antibody
abx176540-02 200 µL

Galectin 12 (LGALS12) Antibody

Sign In for Pricing
View Details
Galectin 12 (LGALS12) Antibody
abx176540-03 1 mL

Galectin 12 (LGALS12) Antibody

Sign In for Pricing
View Details
Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody [Clone ID: LBI1G8]
AMM18611V 100 µL

Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody [Clone ID: LBI1G8]

Sign In for Pricing
View Details
Annexin A10 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-5127R-BF405-TR 20 µL

Annexin A10 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details