Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nodamura virus Protein B2 (B2)

This Recombinant Nodamura virus Protein B2 (B2) spans the amino acid sequence from region 1-137aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B2

UniProt

Q9IMM3

Expression Region

1-137aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Nodamura virus (strain Mag115) (NoV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTNMSCAYELIKSLPAKLEQLAQETQATIQTLMIADPNVNKDLRAFCEFLTVQHQRAYRATNSLLIKPRVAAALRGEELDLGEADVAARVRQLKQQLAELEMEIKPGHQQVAQVSGRRKAAAAAPVAQLGRVGVVNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cr1l Mouse Monoclonal Antibody [Clone ID: 512]
AM31835PU-N 250 µg

Cr1l Mouse Monoclonal Antibody [Clone ID: 512]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lymphoid tissue
CS627816 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
Supervillin (SVIL) Human Gene Knockout Kit (CRISPR)
KN416323 1 Kit

Supervillin (SVIL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RERE Rabbit Polyclonal Antibody
TA366864 100 µL

RERE Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR562746 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
Peptide YY (PYY) (NM_004160) Human Recombinant Protein
TP308334SE 20 µg

Peptide YY (PYY) (NM_004160) Human Recombinant Protein

Sign In for Pricing
View Details