Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Basic leucine zipper transcriptional factor ATF-like (Batf)

This Recombinant Mouse Basic leucine zipper transcriptional factor ATF-like (Batf) spans the amino acid sequence from region 1-125aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell-activating transcription factor

UniProt

O35284

Expression Region

1-125aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Stem Cell & Developmental Biology; Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYSAHAFHQPHISSPRFQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Bromo-2- (cyclopropylsulfanyl) benzene
ZWB22914-01 50 mg

1-Bromo-2- (cyclopropylsulfanyl) benzene

Sign In for Pricing
View Details
1-Bromo-2- (cyclopropylsulfanyl) benzene
ZWB22914-02 0.5 g

1-Bromo-2- (cyclopropylsulfanyl) benzene

Sign In for Pricing
View Details
Choline Acetyltransferase (CHAT) (FITC) discontinued
C5057-10-FITC 100 µL

Choline Acetyltransferase (CHAT) (FITC) discontinued

Sign In for Pricing
View Details
BC001867 Protein Vector (Human) (pPM-C-His)
PV003592 500 ng

BC001867 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
C7orf34 Rabbit pAb, AE conjugated
orb2840845 100 µL

C7orf34 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Lentiviral human PRPF18 sgRNA gene knockout kit - Lentiviral human PRPF18 sgRNA gene knockout kit (plasmid)
GTR15391643 1 Vial

Lentiviral human PRPF18 sgRNA gene knockout kit - Lentiviral human PRPF18 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details