Recombinant Mouse Basic leucine zipper transcriptional factor ATF-like (Batf)
This Recombinant Mouse Basic leucine zipper transcriptional factor ATF-like (Batf) spans the amino acid sequence from region 1-125aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
B-cell-activating transcription factor
UniProt
O35284
Expression Region
1-125aa
Tag
C-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Neuroscience; Stem Cell & Developmental Biology; Pharmacology & Drug Discovery
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
21.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYSAHAFHQPHISSPRFQP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6399324-01 0.1 mL
ZSCAN18 (Zinc Finger and SCAN Domain-containing Protein 18, Zinc Finger Protein 447, ZNF447) (MaxLight 650)
Sign In for Pricing
View Details MBS6399324-02 5x 0.1 mL
ZSCAN18 (Zinc Finger and SCAN Domain-containing Protein 18, Zinc Finger Protein 447, ZNF447) (MaxLight 650)
Sign In for Pricing
View Details 
MBS147059-01 0.002 mg
Recombinant Human Nephroblastoma Overexpressed, HEK
Sign In for Pricing
View Details MBS147059-02 0.01 mg
Recombinant Human Nephroblastoma Overexpressed, HEK
Sign In for Pricing
View Details