Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Bacterioferritin (bfr)

This Recombinant Escherichia coli Bacterioferritin (bfr) spans the amino acid sequence from region 1-158aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome b-1; Cytochrome b-557

UniProt

P0ABD3

Expression Region

1-158aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nociceptin
H-3036.0005 5.0mg

Nociceptin

Sign In for Pricing
View Details
APBA2 (NM_005503) Human Tagged Lenti ORF Clone
RC214824L4 10 µg

APBA2 (NM_005503) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ARAF Protein Lysate
OCOA00555-20UG 20 µg

ARAF Protein Lysate

Sign In for Pricing
View Details
Homeobox Protein NANOG (NANOG) Antibody
abx137438-01 5 µg

Homeobox Protein NANOG (NANOG) Antibody

Sign In for Pricing
View Details
Homeobox Protein NANOG (NANOG) Antibody
abx137438-02 20 µg

Homeobox Protein NANOG (NANOG) Antibody

Sign In for Pricing
View Details
Homeobox Protein NANOG (NANOG) Antibody
abx137438-03 100 µg

Homeobox Protein NANOG (NANOG) Antibody

Sign In for Pricing
View Details