Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Bacterioferritin (bfr)

This Recombinant Escherichia coli Bacterioferritin (bfr) spans the amino acid sequence from region 1-158aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome b-1; Cytochrome b-557

UniProt

P0ABD3

Expression Region

1-158aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzeneacetic acid, 3-fluoro-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -, ethyl ester
PC111461-01 50 mg

Benzeneacetic acid, 3-fluoro-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -, ethyl ester

Sign In for Pricing
View Details
Benzeneacetic acid, 3-fluoro-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -, ethyl ester
PC111461-02 100 mg

Benzeneacetic acid, 3-fluoro-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -, ethyl ester

Sign In for Pricing
View Details
Benzeneacetic acid, 3-fluoro-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -, ethyl ester
PC111461-03 250 mg

Benzeneacetic acid, 3-fluoro-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -, ethyl ester

Sign In for Pricing
View Details
Benzeneacetic acid, 3-fluoro-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -, ethyl ester
PC111461-04 1 g

Benzeneacetic acid, 3-fluoro-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) -, ethyl ester

Sign In for Pricing
View Details
TSLP Rabbit Polyclonal Antibody (Cy3)
orb2614310 100 µg

TSLP Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
HGS Antibody
61-121 400 µL

HGS Antibody

Sign In for Pricing
View Details