Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement C1q subcomponent subunit C (C1QC), partial

This Recombinant Human Complement C1q subcomponent subunit C (C1QC), partial spans the amino acid sequence from region 27-157aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C1QC

UniProt

P02747

Expression Region

27-157aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CCT6B Protein - (Dry Ice)
H00010693-P01-10ug 10 µg

Recombinant Human CCT6B Protein - (Dry Ice)

Sign In for Pricing
View Details
Anti-NSE Rabbit Polyclonal Antibody
PA1251-.1 100 µL

Anti-NSE Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GIDRP88 Antibody
E19-4095 100 µg -100 µL

GIDRP88 Antibody

Sign In for Pricing
View Details
GNAZ, NT (GNAZ, Guanine nucleotide-binding protein G (z) subunit alpha, G (x) alpha chain, Gz-alpha) (MaxLight 550) discontinued
036136-ML550 100 µL

GNAZ, NT (GNAZ, Guanine nucleotide-binding protein G (z) subunit alpha, G (x) alpha chain, Gz-alpha) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Anti-LCMT1  (3D3)
YF-MA18512 100 ug

Anti-LCMT1 (3D3)

Sign In for Pricing
View Details
Chicken Engulfment And Cell Motility 2 (ELMO2) ELISA Kit
abx356820 96 Well

Chicken Engulfment And Cell Motility 2 (ELMO2) ELISA Kit

Sign In for Pricing
View Details