Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chromogranin-A (CHGA), partial

This Recombinant Human Chromogranin-A (CHGA), partial spans the amino acid sequence from region 224-457aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pituitary secretory protein I

UniProt

P10645

Expression Region

224-457aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMP1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-12359R-BF594 100 µL

DMP1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
14-3-3 Tau Recombinant Antibody, Cy5 Conjugated
bsm-52006R-Cy5 100 µL

14-3-3 Tau Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Recombinant Salinispora arenicola Na (+)/H (+) antiporter nhaA 3, partial
MBS1252317-01 1 mg (E-Coli)

Recombinant Salinispora arenicola Na (+)/H (+) antiporter nhaA 3, partial

Sign In for Pricing
View Details
Recombinant Salinispora arenicola Na (+)/H (+) antiporter nhaA 3, partial
MBS1252317-02 1 mg (Yeast)

Recombinant Salinispora arenicola Na (+)/H (+) antiporter nhaA 3, partial

Sign In for Pricing
View Details
Recombinant Yersinia pestis Copper-exporting P-type ATPase A (copA), partial
MBS7095043 Inquire

Recombinant Yersinia pestis Copper-exporting P-type ATPase A (copA), partial

Sign In for Pricing
View Details
ACPT Polyclonal Antibody, HRP Conjugated
bs-6289R-HRP 100 µL

ACPT Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details