Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuronal acetylcholine receptor subunit alpha-9 (CHRNA9), partial, Biotinylated

This Recombinant Human Neuronal acetylcholine receptor subunit alpha-9 (CHRNA9), partial, Biotinylated spans the amino acid sequence from region 26-237aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nicotinic acetylcholine receptor subunit alpha-9

UniProt

Q9UGM1

Expression Region

26-237aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

72.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F-2 discontinued
343044-01 100 µL

E2F-2 discontinued

Sign In for Pricing
View Details
E2F-2 discontinued
343044-02 200 µL

E2F-2 discontinued

Sign In for Pricing
View Details
RPL7AP52 sgRNA CRISPR Lentivector (Human) (Target 2)
K1886503 1.0 µg DNA

RPL7AP52 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
NMRAL1 Recombinant Protein Antigen
NBP1-83554PEP 0.1 mL

NMRAL1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant Lassa virus Nucleoprotein (N)
CSB-EP318401LNP-01 20 µg

Recombinant Lassa virus Nucleoprotein (N)

Sign In for Pricing
View Details
Recombinant Lassa virus Nucleoprotein (N)
CSB-EP318401LNP-02 100 µg

Recombinant Lassa virus Nucleoprotein (N)

Sign In for Pricing
View Details