Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH), partial

This Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH), partial spans the amino acid sequence from region 31-395aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dihydroorotate oxidase

UniProt

Q02127

Expression Region

31-395aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SULT1A1 siRNA (m)
sc-155969 10 µM

SULT1A1 siRNA (m)

Sign In for Pricing
View Details
Goat Anti Cat Iga Polyclonal Antibody,HRP
DPBT-67154GC 1 mg

Goat Anti Cat Iga Polyclonal Antibody,HRP

Sign In for Pricing
View Details
PCOLCE2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV646954 1.0 µg DNA

PCOLCE2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Scyliorhinus canicula NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)
MBS7022089-01 0.02 mg

Recombinant Scyliorhinus canicula NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Sign In for Pricing
View Details
Recombinant Scyliorhinus canicula NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)
MBS7022089-02 0.1 mg

Recombinant Scyliorhinus canicula NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Sign In for Pricing
View Details
Recombinant Scyliorhinus canicula NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)
MBS7022089-03 5x 0.1 mg

Recombinant Scyliorhinus canicula NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Sign In for Pricing
View Details