Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dehydrogenase/reductase SDR family member 4 (DHRS4), partial

This Recombinant Human Dehydrogenase/reductase SDR family member 4 (DHRS4), partial spans the amino acid sequence from region 160-219aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NADPH-dependent carbonyl reductase; NADPH-dependent retinol dehydrogenase/reductase; Peroxisomal short-chain alcohol dehydrogenase; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Short-chain dehydrogenase/reductase family member 4

UniProt

Q9BTZ2

Expression Region

160-219aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody
NBP2-94679-0.1mL 0.1 mL

Rabbit Polyclonal Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody

Sign In for Pricing
View Details
Anti-Neutrophil Elastase/ELANE Antibody Picoband® Fluoro594 Conjugated
PB10058-Fluoro594 100 µg/Vial

Anti-Neutrophil Elastase/ELANE Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Follistatin (FS)
MBS2041798-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Follistatin (FS)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Follistatin (FS)
MBS2041798-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Follistatin (FS)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Follistatin (FS)
MBS2041798-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Follistatin (FS)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Follistatin (FS)
MBS2041798-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Follistatin (FS)

Sign In for Pricing
View Details