Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Deoxyribonuclease gamma (DNASE1L3)

This Recombinant Human Deoxyribonuclease gamma (DNASE1L3) spans the amino acid sequence from region 21-305aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNase I homolog protein DHP2; Deoxyribonuclease I-like 3; Liver and spleen DNase

UniProt

Q13609

Expression Region

21-305aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR51J1 AAV Vector (Human) (CMV)
35303101 1 µg

OR51J1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
SFRS2 (PR264, SC-35, SC35, SFRS2A, SRp30b)
470159 50 µg

SFRS2 (PR264, SC-35, SC35, SFRS2A, SRp30b)

Sign In for Pricing
View Details
Recombinant Human POTEJ Protein
E30P12064 20 µg

Recombinant Human POTEJ Protein

Sign In for Pricing
View Details
IL1 alpha (IL1A) (NM_000575) Human Tagged ORF Clone Lentiviral Particle
RC202084L2V 200 µL

IL1 alpha (IL1A) (NM_000575) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
2410004B18Rik ORF Vector (Mouse) (pORF)
10426014 1.0 µg DNA

2410004B18Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Human AGRN knockdown cell line
ABC-KD0408 1 Vial

Human AGRN knockdown cell line

Sign In for Pricing
View Details