Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3)

This Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3) spans the amino acid sequence from region 36-463aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DPEP3

UniProt

Q4R7M2

Expression Region

36-463aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cancer Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GETTTGAPRALSTLGFPSPFTTPGVPSTLTTPGLTTPGTTKTLDLRSRAQALMRDFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHSQTSLDRLRDGLVGAQFWSASVSCQTQDQTAVRLALEQIDLIRRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCNTPWAESSTKFTHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLMRRVLEVSRAPVIFSHSAARAVCDNSLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGAGRFPQGLEDVSTYPVLIEELLSRSWSEKELQGVLRGNLLRVFRQAEKVREESRAQSPMEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKWPTNRVPWRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Cellulolyticum sfsA Protein (aa 1-226)
VAng-Lsx9050-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Cellulolyticum sfsA Protein (aa 1-226)

Sign In for Pricing
View Details
Anti-Lnpk Antibody (1B10)
TMAC-02413-01 50 μL

Anti-Lnpk Antibody (1B10)

Sign In for Pricing
View Details
Anti-Lnpk Antibody (1B10)
TMAC-02413-02 100 µL

Anti-Lnpk Antibody (1B10)

Sign In for Pricing
View Details
Goat Fibroblast Growth Factor 21 ELISA Kit
MBS047045 Inquire

Goat Fibroblast Growth Factor 21 ELISA Kit

Sign In for Pricing
View Details
1- (2-chloro-6-fluorophenyl) -2-methylpropan-1-ol
PC1010438-01 250 mg

1- (2-chloro-6-fluorophenyl) -2-methylpropan-1-ol

Sign In for Pricing
View Details
1- (2-chloro-6-fluorophenyl) -2-methylpropan-1-ol
PC1010438-02 500 mg

1- (2-chloro-6-fluorophenyl) -2-methylpropan-1-ol

Sign In for Pricing
View Details