Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 34 Protein E7 (E7)

This Recombinant Human papillomavirus type 34 Protein E7 (E7) spans the amino acid sequence from region 1-97aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E7

UniProt

P36828

Expression Region

1-97aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human papillomavirus type 34

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MHGKKPSVQDIVLDLKPTTETDLTCYESLDNSEDEDETDSHLERQAEQAWYRIVTDCSRCQSTVCLTIESTHADLLVLEDLLMGALKIVCPNCSRRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Promurit
166027 250 mg

Promurit

Sign In for Pricing
View Details
Dihydrodehydrodiconiferyl alcohol 9-Oglucoside
orb1942215 5 mg

Dihydrodehydrodiconiferyl alcohol 9-Oglucoside

Sign In for Pricing
View Details
Akr1b7 AAV siRNA Pooled Vector
11683164 1.0 µg

Akr1b7 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Sesamin (+)
orb1304844-01 10 mg

Sesamin (+)

Sign In for Pricing
View Details
Sesamin (+)
orb1304844-02 50 mg

Sesamin (+)

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans ceh-33 Protein (aa 1-261)
VAng-Ly3213-50gEcoli 50 µg (E. coli)

Recombinant Caenorhabditis Elegans ceh-33 Protein (aa 1-261)

Sign In for Pricing
View Details