Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Follitropin subunit beta (FSHB)

This Recombinant Horse Follitropin subunit beta (FSHB) spans the amino acid sequence from region 19-129aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Follicle-stimulating hormone beta subunit; Follitropin beta chain

UniProt

P01226

Expression Region

19-129aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Equus caballus (Horse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSCELTNITIAVEKEECGFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVKVPGCAHHADSLYTYPVATACHCGKCNSDSTDCTVRGLGPSYCSFGDMKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse BNP (Brain Natriuretic Peptide) ELISA Kit
EM0877 96 Tests

Mouse BNP (Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal CYP39A1 Antibody [Alexa Fluor 405]
NBP2-97435AF405 0.1 mL

Rabbit Polyclonal CYP39A1 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
TMPRSS11A Human Gene Knockout Kit (CRISPR)
KN421395 1 Kit

TMPRSS11A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hexadimethrine bromide 200mg
A19447-200 200 mg

Hexadimethrine bromide 200mg

Sign In for Pricing
View Details
FAM65B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
20077111 3x 1.0 µg

FAM65B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral human NDUFA4L2 sgRNA gene knockout kit - Lentiviral human NDUFA4L2 sgRNA gene knockout kit (25)
GTR15382578 1 Vial

Lentiviral human NDUFA4L2 sgRNA gene knockout kit - Lentiviral human NDUFA4L2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details