Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine leukemia virus Gag polyprotein (gag), partial

This Recombinant Bovine leukemia virus Gag polyprotein (gag), partial spans the amino acid sequence from region 110-323aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gag

UniProt

P25058

Expression Region

110-323aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bovine leukemia virus (isolate Australian) (BLV)

Field of Research

Infectious Disease & Virology; Cancer Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PIISEGNRNRHRAWALRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQLCQYIASPVDQTAHMTSLTAAIAAEAANTLQGFNPKMGTLTQQSAQPNAGDLRSQYQNLWLQAWKNLPTRPSVQPWSTIVQGPAESYVEFVNRLQISLADNLPDGVPKEPIIDSLSYANANKECQQILQGRGLVAAPVGQKLQACAHWAPKTKQPAIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CXCL13 Recombinant Rabbit Monoclonal Antibody [PSH07-05] - BSA and Azide free (Capture)
HA722791 100 µL

Human CXCL13 Recombinant Rabbit Monoclonal Antibody [PSH07-05] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
Mouse Hdgf activation kit by CRISPRa
GA201866 1 Kit

Mouse Hdgf activation kit by CRISPRa

Sign In for Pricing
View Details
EnzyFluo™ MMP-1 Inhibitor Assay Kit
EIMP1-100 100 Tests

EnzyFluo™ MMP-1 Inhibitor Assay Kit

Sign In for Pricing
View Details
Magnetic Polystyrene AM NH₂
HMAG10002.25 25 g

Magnetic Polystyrene AM NH₂

Sign In for Pricing
View Details
ARHGAP30 Rabbit Polyclonal Antibody
TA373652 100 µL

ARHGAP30 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), CF740 conjugate, 0.1mg/mL
BNC741968-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details