Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 4 (GP4), partial

This Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 4 (GP4), partial spans the amino acid sequence from region 23-160aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GP4

UniProt

A0MD33

Expression Region

23-160aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) (PRRSV

Field of Research

Infectious Disease & Virology; Immunology & Inflammation; Respiratory Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CKPCFSTHLSDIKTNTTAAAGFMVLQNINCSRPHEASATQGQVPSRKSSQCREAVGVPQYITITANVTDESYLYNADLLMLSACLFYASEMSEKGFKVIFGNVSGVVSACVNFTDYVAHVTQHTQQHHLVINHIRLLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-500 1x 500 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-100 1x 100 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF568 conjugate, 0.1mg/mL
BNC680449-100 1x 100 µL

CD104 (UM-A9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), CF647 conjugate, 0.1mg/mL
BNC472137-100 1x 100 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF640R conjugate, 0.1mg/mL
BNC402983-100 1x 100 µL

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-intact (HCGab/52), CF594 conjugate, 0.1mg/mL
BNC940052-100 1x 100 µL

HCG-intact (HCGab/52), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details