Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granzyme A (Gzma)

This Recombinant Mouse Granzyme A (Gzma) spans the amino acid sequence from region 29-260aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Autocrine thymic lymphoma granzyme-like serine protease; CTLA-3; Fragmentin-1; T cell-specific serine protease 1

UniProt

P11032

Expression Region

29-260aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human NUP160 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot) 200ul
IRBAHUNUP160AP444200UL 200 µL

Rabbit Anti Human NUP160 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot) 200ul

Sign In for Pricing
View Details
C9orf66 sgRNA CRISPR Lentivector set (Human)
K0267601 3x 1.0 µg

C9orf66 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant SPRY4 Rabbit mAb
E38MA4590 100 µL

Recombinant SPRY4 Rabbit mAb

Sign In for Pricing
View Details
Lentiviral mouse Gabra1 shRNA (UAS) - Lentiviral mouse Gabra1 shRNA (UAS, GFP) (100)
GTR15168405 1 Vial

Lentiviral mouse Gabra1 shRNA (UAS) - Lentiviral mouse Gabra1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Mix-n-StainTM CF®640R Antibody Labeling Kit, 1x (5-20ug) labeling
#92278 1 Kit

Mix-n-StainTM CF®640R Antibody Labeling Kit, 1x (5-20ug) labeling

Sign In for Pricing
View Details
Human IL21 Protein Lysate 20ug
IHUIL21PLLY20UG 20 µg

Human IL21 Protein Lysate 20ug

Sign In for Pricing
View Details