Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granzyme A (Gzma)

This Recombinant Mouse Granzyme A (Gzma) spans the amino acid sequence from region 29-260aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Autocrine thymic lymphoma granzyme-like serine protease; CTLA-3; Fragmentin-1; T cell-specific serine protease 1

UniProt

P11032

Expression Region

29-260aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF462 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2393874 100 µL

ZNF462 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
EGFR Antibody (Ser1070)
MBS5313527-01 0.1 mg

EGFR Antibody (Ser1070)

Sign In for Pricing
View Details
EGFR Antibody (Ser1070)
MBS5313527-02 5x 0.1 mg

EGFR Antibody (Ser1070)

Sign In for Pricing
View Details
Human MTR Pre-designed siRNA Set B
SI010011B 1 Each

Human MTR Pre-designed siRNA Set B

Sign In for Pricing
View Details
TRITC Anti-human CD11a Antibody *R7-1*
101141J1-AAT 500 Tests

TRITC Anti-human CD11a Antibody *R7-1*

Sign In for Pricing
View Details
Bovine Olfactory receptor 1S2 (OR1S2) ELISA Kit
OM617347 96 Strip Well

Bovine Olfactory receptor 1S2 (OR1S2) ELISA Kit

Sign In for Pricing
View Details