Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin (INS)

This Recombinant Human Insulin (INS) spans the amino acid sequence from region 25-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

INS

UniProt

P01308

Expression Region

25-110aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RL ELISA Kit (Ready to Use)
orb552192-01 48 Tests

Human RL ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human RL ELISA Kit (Ready to Use)
orb552192-02 96 Tests

Human RL ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Quantitative Filter Papers, Grade 44, Slow, 3um, 180mm, 100pcs/pk
22011230 100 PCS

Quantitative Filter Papers, Grade 44, Slow, 3um, 180mm, 100pcs/pk

Sign In for Pricing
View Details
OSBP2 CRISPR/Cas9 KO Plasmid (h)
sc-405244 20 µg

OSBP2 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Human N-myc Downstream Regulated 1 protein (NDRG1) AssayLite™ Antibody (APC Conjugate)
35749-05161 5x 30 µg

Human N-myc Downstream Regulated 1 protein (NDRG1) AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details
CCDC109B Adenovirus (Mouse)
15173054 1.0 mL

CCDC109B Adenovirus (Mouse)

Sign In for Pricing
View Details