Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras GTPase-activating-like protein IQGAP1 (IQGAP1), partial

This Recombinant Human Ras GTPase-activating-like protein IQGAP1 (IQGAP1), partial spans the amino acid sequence from region 505-717aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P195

UniProt

P46940

Expression Region

505-717aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmprss2 Rat Pre-designed siRNA Set A
HY-RS23176 1 Set

Tmprss2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-NGF/NGF Beta Antibody Picoband® (HRP Conjugate)
A00341-HRP 100 µg/Vial

Anti-NGF/NGF Beta Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details
Recombinant human NDRG3 protein
ATGP2841-250 250 µg

Recombinant human NDRG3 protein

Sign In for Pricing
View Details
SART3 (NM_014706) Human Over-expression Lysate
LC415084 20 µg

SART3 (NM_014706) Human Over-expression Lysate

Sign In for Pricing
View Details
DDIT4L Antibody
CSB-PA853399LA01HU-01 50 µg

DDIT4L Antibody

Sign In for Pricing
View Details
DDIT4L Antibody
CSB-PA853399LA01HU-02 100 µg

DDIT4L Antibody

Sign In for Pricing
View Details